Anti-TMEM106B
Catalog Number:
ATA-HPA058342
- Images (9)
| Article Name: | Anti-TMEM106B |
| Biozol Catalog Number: | ATA-HPA058342 |
| Supplier Catalog Number: | HPA058342 |
| Alternative Catalog Number: | ATA-HPA058342-100,ATA-HPA058342-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ11273, MGC33727 |
| transmembrane protein 106B |
| Anti-TMEM106B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 54664 |
| UniProt: | Q9NUM4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMEM106B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A549 shows localization to endosomes & lysosomes. |
|
|
Immunohistochemical staining of human cerebral cortex shows positivity in neuronal cells. |
|
|
Immunohistochemical staining of human cerebellum shows positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA058342-100ul |
|
|
|
|
|
HPA058342-100ul |
|
|
HPA058342-100ul |
Product Guarantee and Expert Support
