Anti-SETD1A
Catalog Number:
ATA-HPA058376
- Images (9)
| Article Name: | Anti-SETD1A |
| Biozol Catalog Number: | ATA-HPA058376 |
| Supplier Catalog Number: | HPA058376 |
| Alternative Catalog Number: | ATA-HPA058376-100,ATA-HPA058376-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0339, KMT2F, Set1 |
| SET domain containing 1A |
| Anti-SETD1A |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9739 |
| UniProt: | O15047 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SETD1A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SETD1A antibody. Corresponding SETD1A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-SETD1A antibody HPA058376 (A) shows similar protein distribution across tissues to independent antibody HPA020646 (B). |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human kidney using Anti-SETD1A antibody HPA058376. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-SETD1A antibody HPA058376. |
|
|
HPA058376-100ul |
|
|
HPA058376-100ul |
|
|
HPA058376-100ul |
Product Guarantee and Expert Support
