Anti-DMTN

Catalog Number: ATA-HPA058487
Article Name: Anti-DMTN
Biozol Catalog Number: ATA-HPA058487
Supplier Catalog Number: HPA058487
Alternative Catalog Number: ATA-HPA058487-100,ATA-HPA058487-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DMT, EPB49
Clonality: Polyclonal
Isotype: IgG
NCBI: 2039
UniProt: Q08495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT
Target: DMTN
Antibody Type: Monoclonal Antibody
HPA058487-100ul