Anti-GOT2

Catalog Number: ATA-HPA058537
Article Name: Anti-GOT2
Biozol Catalog Number: ATA-HPA058537
Supplier Catalog Number: HPA058537
Alternative Catalog Number: ATA-HPA058537-100,ATA-HPA058537-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KAT4, KATIV, KYAT4, mitAAT
Clonality: Polyclonal
Concentration: 0,2
NCBI: 2806
UniProt: P00505
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHA
Target: GOT2
HPA058537-100ul