Anti-DNAJB6
Catalog Number:
ATA-HPA058593
- Images (6)
| Article Name: | Anti-DNAJB6 |
| Biozol Catalog Number: | ATA-HPA058593 |
| Supplier Catalog Number: | HPA058593 |
| Alternative Catalog Number: | ATA-HPA058593-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LGMD1D, MRJ |
| DnaJ (Hsp40) homolog, subfamily B, member 6 |
| Anti-DNAJB6 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 10049 |
| UniProt: | O75190 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJB6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts, Leydig cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA058593-100ul |
|
|
HPA058593-100ul |
|
|
HPA058593-100ul |
Product Guarantee and Expert Support
