Anti-KRT82
Catalog Number:
ATA-HPA058715
- Images (8)
| Article Name: | Anti-KRT82 |
| Biozol Catalog Number: | ATA-HPA058715 |
| Supplier Catalog Number: | HPA058715 |
| Alternative Catalog Number: | ATA-HPA058715-100,ATA-HPA058715-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Hb-2, KRTHB2 |
| keratin 82 |
| Anti-KRT82 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3888 |
| UniProt: | Q9NSB4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | KRT82 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human colon, kidney, skin, hairy and testis using Anti-KRT82 antibody HPA058715 (A) shows similar protein distribution across tissues to independent antibody HPA067230 (B). |
|
|
Immunohistochemical staining of human colon using Anti-KRT82 antibody HPA058715. |
|
|
Immunohistochemical staining of human testis using Anti-KRT82 antibody HPA058715. |
|
|
Immunohistochemical staining of human skin, hairy using Anti-KRT82 antibody HPA058715. |
|
|
Immunohistochemical staining of human kidney using Anti-KRT82 antibody HPA058715. |
|
|
HPA058715-100ul |
|
|
HPA058715-100ul |
|
|
HPA058715-100ul |
Product Guarantee and Expert Support
