Anti-FAM222A

Catalog Number: ATA-HPA058774
Article Name: Anti-FAM222A
Biozol Catalog Number: ATA-HPA058774
Supplier Catalog Number: HPA058774
Alternative Catalog Number: ATA-HPA058774-100,ATA-HPA058774-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C12orf34, FLJ14721
Clonality: Polyclonal
Isotype: IgG
NCBI: 84915
UniProt: Q5U5X8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA
Target: FAM222A
Antibody Type: Monoclonal Antibody
HPA058774-100ul