Anti-PCGF5

Catalog Number: ATA-HPA059071
Article Name: Anti-PCGF5
Biozol Catalog Number: ATA-HPA059071
Supplier Catalog Number: HPA059071
Alternative Catalog Number: ATA-HPA059071-100,ATA-HPA059071-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC16202, RNF159
Clonality: Polyclonal
Isotype: IgG
NCBI: 84333
UniProt: Q86SE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRID
Target: PCGF5
Antibody Type: Monoclonal Antibody
HPA059071-100ul