Anti-NNMT
Catalog Number:
ATA-HPA059180
- Images (9)
| Article Name: | Anti-NNMT |
| Biozol Catalog Number: | ATA-HPA059180 |
| Supplier Catalog Number: | HPA059180 |
| Alternative Catalog Number: | ATA-HPA059180-100,ATA-HPA059180-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NNMT |
| nicotinamide N-methyltransferase |
| Anti-NNMT |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 4837 |
| UniProt: | P40261 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NNMT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes. |
|
|
Western blot analysis in human cell lines U2OS and SK-MEL-30 using Anti-NNMT antibody. Corresponding NNMT RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
HPA059180-100ul |
|
|
HPA059180-100ul |
|
|
HPA059180 |
|
|
HPA059180 |
|
|
HPA059180 |
Product Guarantee and Expert Support
