Anti-ZNF202

Catalog Number: ATA-HPA059229
Article Name: Anti-ZNF202
Biozol Catalog Number: ATA-HPA059229
Supplier Catalog Number: HPA059229
Alternative Catalog Number: ATA-HPA059229-100,ATA-HPA059229-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZKSCAN10, ZSCAN42
Clonality: Polyclonal
Isotype: IgG
NCBI: 7753
UniProt: O95125
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNS
Target: ZNF202
Antibody Type: Monoclonal Antibody
HPA059229-100ul