Anti-CLCA1

Catalog Number: ATA-HPA059301
Article Name: Anti-CLCA1
Biozol Catalog Number: ATA-HPA059301
Supplier Catalog Number: HPA059301
Alternative Catalog Number: ATA-HPA059301-100,ATA-HPA059301-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CaCC, CLCRG1
chloride channel accessory 1
Anti-CLCA1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1179
UniProt: A8K7I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KVRALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CLCA1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-CLCA1 antibody. Corresponding CLCA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, liver, small intestine and testis using Anti-CLCA1 antibody HPA059301 (A) shows similar protein distribution across tissues to independent antibody HPA052787 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human testis using Anti-CLCA1 antibody HPA059301.
Immunohistochemical staining of human colon using Anti-CLCA1 antibody HPA059301.
HPA059301-100ul
HPA059301-100ul
HPA059301-100ul