Anti-GCNT7

Catalog Number: ATA-HPA059403
Article Name: Anti-GCNT7
Biozol Catalog Number: ATA-HPA059403
Supplier Catalog Number: HPA059403
Alternative Catalog Number: ATA-HPA059403-100,ATA-HPA059403-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C20orf105, dJ1153D9.2
Clonality: Polyclonal
Isotype: IgG
NCBI: 140687
UniProt: Q6ZNI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TDIHAKDMLQWSKDIRSPEQHYWVTLNRLKDAPGATPNAGWEGNVRAIKRKSEEGNVHDGCKGRYVEDICVYGPGD
Target: GCNT7
Antibody Type: Monoclonal Antibody
HPA059403-100ul