Anti-CARD9
Catalog Number:
ATA-HPA059502
- Images (9)
| Article Name: | Anti-CARD9 |
| Biozol Catalog Number: | ATA-HPA059502 |
| Supplier Catalog Number: | HPA059502 |
| Alternative Catalog Number: | ATA-HPA059502-100,ATA-HPA059502-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CARD9 |
| caspase recruitment domain family, member 9 |
| Anti-CARD9 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 64170 |
| UniProt: | Q9H257 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GSPKQPFAALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CARD9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using HPA059502 antibody. Corresponding CARD9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in a subset of leukocytes. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human spleen shows weak to moderate cytoplasmic positivity in a subset of leukocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
HPA059502-100ul |
|
|
HPA059502-100ul |
|
|
HPA059502-100ul |
Product Guarantee and Expert Support
