Anti-CT55

Catalog Number: ATA-HPA059575
Article Name: Anti-CT55
Biozol Catalog Number: ATA-HPA059575
Supplier Catalog Number: HPA059575
Alternative Catalog Number: ATA-HPA059575-100,ATA-HPA059575-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CXorf48, FLJ20527
Clonality: Polyclonal
Isotype: IgG
NCBI: 54967
UniProt: Q8WUE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG
Target: CT55
Antibody Type: Monoclonal Antibody
HPA059575-100ul