Anti-TTC7B
Catalog Number:
ATA-HPA059577
- Images (3)
| Article Name: | Anti-TTC7B |
| Biozol Catalog Number: | ATA-HPA059577 |
| Supplier Catalog Number: | HPA059577 |
| Alternative Catalog Number: | ATA-HPA059577-100,ATA-HPA059577-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TTC7L1 |
| Clonality: | Polyclonal |
| NCBI: | 145567 |
| UniProt: | Q86TV6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HYHDALNIIDMALSEYPENFILLFSKVKLQSLCRGPDEALLTCKHMLQIWKSCYNLTNPSDSGRGSSLLDRTIADRRQLNTITLPDFSD |
| Target: | TTC7B |
|
|
HPA059577-100ul |
|
|
HPA059577-100ul |
|
|
HPA059577-100ul |
Product Guarantee and Expert Support
