Anti-MYO19

Product Overview

• Article Name: Anti-MYO19
• Biozol Catalog Number: ATA-HPA059715
• Supplier Catalog Number: HPA059715
• Alternative Catalog Number: ATA-HPA059715-100,ATA-HPA059715-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ22865, MYOHD1

Product Properties

• Clonality: Polyclonal
• NCBI: 80179
• UniProt: Q96H55
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: FYQICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVLAGLL
• Target: MYO19