Anti-FNDC8

Catalog Number: ATA-HPA059803
Article Name: Anti-FNDC8
Biozol Catalog Number: ATA-HPA059803
Supplier Catalog Number: HPA059803
Alternative Catalog Number: ATA-HPA059803-100,ATA-HPA059803-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp434H2215
Clonality: Polyclonal
Concentration: 0,1
NCBI: 54752
UniProt: Q8TC99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMRRLEDLEYLFPC
Target: FNDC8
HPA059803-100ul