Anti-PRY2

Catalog Number: ATA-HPA059887
Article Name: Anti-PRY2
Biozol Catalog Number: ATA-HPA059887
Supplier Catalog Number: HPA059887
Alternative Catalog Number: ATA-HPA059887-100,ATA-HPA059887-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PTPN13LY2
Clonality: Polyclonal
Isotype: IgG
NCBI: 442862
UniProt: O14603
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQSFLLRTLERGRGFRAL
Target: PRY2
Antibody Type: Monoclonal Antibody
HPA059887-100ul