Anti-GRHL3

Catalog Number: ATA-HPA059960
Article Name: Anti-GRHL3
Biozol Catalog Number: ATA-HPA059960
Supplier Catalog Number: HPA059960
Alternative Catalog Number: ATA-HPA059960-100,ATA-HPA059960-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SOM, TFCP2L4
grainyhead-like transcription factor 3
Anti-GRHL3
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 57822
UniProt: Q8TE85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GRHL3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry analysis in human urinary bladder and skeletal muscle tissues using Anti-GRHL3 antibody. Corresponding GRHL3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human urinary bladder shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA059960-100ul
HPA059960-100ul
HPA059960-100ul