Anti-C19orf43

Catalog Number: ATA-HPA059965
Article Name: Anti-C19orf43
Biozol Catalog Number: ATA-HPA059965
Supplier Catalog Number: HPA059965
Alternative Catalog Number: ATA-HPA059965-100,ATA-HPA059965-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: fSAP18, MGC2803
chromosome 19 open reading frame 43
Anti-C19orf43
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 79002
UniProt: Q9BQ61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GSTLSFVGKRRGGNKLALKTGIVAKKQKTEDEVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: C19orf43
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemical staining of human vagina shows strong nuclear positivity in squamous epithelial cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line MCF-7
HPA059965-100ul
HPA059965-100ul
HPA059965-100ul