Anti-LTF
Catalog Number:
ATA-HPA059976
- Images (7)
| Article Name: | Anti-LTF |
| Biozol Catalog Number: | ATA-HPA059976 |
| Supplier Catalog Number: | HPA059976 |
| Alternative Catalog Number: | ATA-HPA059976-100,ATA-HPA059976-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HLF2 |
| lactotransferrin |
| Anti-LTF |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 4057 |
| UniProt: | P02788 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LTF |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human salivary gland and pancreas tissues using Anti-LTF antibody. Corresponding LTF RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human salivary gland shows high expression. |
|
|
Immunohistochemical staining of human lactating breast shows moderate membranous positivity with additional plasma positivity. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA059976-100ul |
|
|
HPA059976-100ul |
|
|
HPA059976-100ul |
Product Guarantee and Expert Support
