Anti-ALKBH1

Catalog Number: ATA-HPA060061
Article Name: Anti-ALKBH1
Biozol Catalog Number: ATA-HPA060061
Supplier Catalog Number: HPA060061
Alternative Catalog Number: ATA-HPA060061-100,ATA-HPA060061-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ABH, alkB, ALKBH, hABH
Clonality: Polyclonal
Isotype: IgG
NCBI: 8846
UniProt: Q13686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLD
Target: ALKBH1
Antibody Type: Monoclonal Antibody
HPA060061-100ul