Anti-PROB1

Catalog Number: ATA-HPA060103
Article Name: Anti-PROB1
Biozol Catalog Number: ATA-HPA060103
Supplier Catalog Number: HPA060103
Alternative Catalog Number: ATA-HPA060103-100,ATA-HPA060103-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C5orf65
proline-rich basic protein 1
Anti-PROB1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 389333
UniProt: E7EW31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VKTTYAPGFPAGAQGSGLPAPPADPCGEEGGESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PROB1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-PROB1 antibody. Corresponding PROB1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA060103-100ul
HPA060103-100ul
HPA060103-100ul