Anti-MYO1B

Catalog Number: ATA-HPA060144
Article Name: Anti-MYO1B
Biozol Catalog Number: ATA-HPA060144
Supplier Catalog Number: HPA060144
Alternative Catalog Number: ATA-HPA060144-100,ATA-HPA060144-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: myr1
myosin IB
Anti-MYO1B
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 4430
UniProt: O43795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MYO1B
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes and bile duct cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line PC-3
HPA060144-100ul
HPA060144-100ul
HPA060144-100ul