Anti-PITPNM1

Catalog Number: ATA-HPA060227
Article Name: Anti-PITPNM1
Biozol Catalog Number: ATA-HPA060227
Supplier Catalog Number: HPA060227
Alternative Catalog Number: ATA-HPA060227-100,ATA-HPA060227-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DRES9, NIR2, PITPNM, Rd9, RDGB, RDGB1, RDGBA1
phosphatidylinositol transfer protein, membrane-associated 1
Anti-PITPNM1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9600
UniProt: O00562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PITPNM1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to cytosol & cytoplasmic bodies.
Immunohistochemical staining of human fallopian tube shows cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA060227-100ul
HPA060227-100ul
HPA060227-100ul