Anti-IFI44L
Catalog Number:
ATA-HPA060372
- Images (8)
| Article Name: | Anti-IFI44L |
| Biozol Catalog Number: | ATA-HPA060372 |
| Supplier Catalog Number: | HPA060372 |
| Alternative Catalog Number: | ATA-HPA060372-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf29, GS3686 |
| interferon-induced protein 44-like |
| Anti-IFI44L |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 10964 |
| UniProt: | Q53G44 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNLKLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNRLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IFI44L |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human gallbladder and rectum tissues using Anti-IFI44L antibody. Corresponding IFI44L RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gallbladder shows high expression. |
|
|
Immunohistochemical staining of human rectum shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
|
|
|
HPA060372-100ul |
|
|
HPA060372-100ul |
|
|
HPA060372-100ul |
Product Guarantee and Expert Support
