Anti-NOXRED1

Catalog Number: ATA-HPA060408
Article Name: Anti-NOXRED1
Biozol Catalog Number: ATA-HPA060408
Supplier Catalog Number: HPA060408
Alternative Catalog Number: ATA-HPA060408-100,ATA-HPA060408-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C14orf148, FLJ32809
Clonality: Polyclonal
Concentration: 0,05
NCBI: 122945
UniProt: Q6NXP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LGIKCFYHNADLVSWADVIFLCCLPSQLPNICVEIYTSLEKASIVYSFVAAIPLPRLKLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATC
Target: NOXRED1
HPA060408-100ul