Anti-CBFA2T2

Catalog Number: ATA-HPA060523
Article Name: Anti-CBFA2T2
Biozol Catalog Number: ATA-HPA060523
Supplier Catalog Number: HPA060523
Alternative Catalog Number: ATA-HPA060523-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MTGR1, ZMYND3
core-binding factor, runt domain, alpha subunit 2, translocated to, 2
Anti-CBFA2T2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 9139
UniProt: O43439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CBFA2T2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and liver tissues using Anti-CBFA2T2 antibody. Corresponding CBFA2T2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA060523-100ul
HPA060523-100ul
HPA060523-100ul