Anti-SH2B1

Catalog Number: ATA-HPA060663
Article Name: Anti-SH2B1
Biozol Catalog Number: ATA-HPA060663
Supplier Catalog Number: HPA060663
Alternative Catalog Number: ATA-HPA060663-100,ATA-HPA060663-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ30542, SH2B
Clonality: Polyclonal
Isotype: IgG
NCBI: 25970
UniProt: Q9NRF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: REFCESHARAAALDFARRFRLYLASHPQYAGPGAEAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEIS
Target: SH2B1
Antibody Type: Monoclonal Antibody
HPA060663-100ul