Anti-ZNF169

Catalog Number: ATA-HPA061185
Article Name: Anti-ZNF169
Biozol Catalog Number: ATA-HPA061185
Supplier Catalog Number: HPA061185
Alternative Catalog Number: ATA-HPA061185-100,ATA-HPA061185-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC51961
Clonality: Polyclonal
Isotype: IgG
NCBI: 169841
UniProt: Q14929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSE
Target: ZNF169
Antibody Type: Monoclonal Antibody
HPA061185-100ul