Anti-LSM14B
Catalog Number:
ATA-HPA061189
- Images (8)
| Article Name: | Anti-LSM14B |
| Biozol Catalog Number: | ATA-HPA061189 |
| Supplier Catalog Number: | HPA061189 |
| Alternative Catalog Number: | ATA-HPA061189-100,ATA-HPA061189-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bA11M20.3, C20orf40, FAM61B, FLJ25473, FT005, LSM13, RAP55B |
| LSM family member 14B |
| Anti-LSM14B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 149986 |
| UniProt: | Q9BX40 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASLGLGAGFPSIPVGKSPMVEQAVQTGSADNLNAK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LSM14B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to vesicles. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and LSM14B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408171). |
|
|
HPA061189-100ul |
|
|
|
|
|
|
|
|
HPA061189-100ul |
|
|
HPA061189-100ul |
Product Guarantee and Expert Support
