Anti-BMP7

Catalog Number: ATA-HPA061339
Article Name: Anti-BMP7
Biozol Catalog Number: ATA-HPA061339
Supplier Catalog Number: HPA061339
Alternative Catalog Number: ATA-HPA061339-100,ATA-HPA061339-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: OP-1
Clonality: Polyclonal
Concentration: 0,1
NCBI: 655
UniProt: P18075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLT
Target: BMP7
HPA061339-100ul