Anti-DIXDC1

Catalog Number: ATA-HPA061366
Article Name: Anti-DIXDC1
Biozol Catalog Number: ATA-HPA061366
Supplier Catalog Number: HPA061366
Alternative Catalog Number: ATA-HPA061366-100,ATA-HPA061366-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Dixin, KIAA1735
Clonality: Polyclonal
Concentration: 0,05
NCBI: 85458
UniProt: Q155Q3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALD
Target: DIXDC1
HPA061366-100ul