Anti-NAV3

Catalog Number: ATA-HPA061392
Article Name: Anti-NAV3
Biozol Catalog Number: ATA-HPA061392
Supplier Catalog Number: HPA061392
Alternative Catalog Number: ATA-HPA061392-100,ATA-HPA061392-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0938, POMFIL1
Clonality: Polyclonal
Isotype: IgG
NCBI: 89795
UniProt: Q8IVL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD
Target: NAV3
Antibody Type: Monoclonal Antibody
HPA061392-100ul