Anti-DNAH6

Catalog Number: ATA-HPA061401
Article Name: Anti-DNAH6
Biozol Catalog Number: ATA-HPA061401
Supplier Catalog Number: HPA061401
Alternative Catalog Number: ATA-HPA061401-100,ATA-HPA061401-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Dnahc6, DNHL1, FLJ37357, HL-2
Clonality: Polyclonal
Isotype: IgG
NCBI: 1768
UniProt: Q9C0G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLG
Target: DNAH6
Antibody Type: Monoclonal Antibody
HPA061401-100ul