Anti-ENKUR
Catalog Number:
ATA-HPA061503
- Images (9)
| Article Name: | Anti-ENKUR |
| Biozol Catalog Number: | ATA-HPA061503 |
| Supplier Catalog Number: | HPA061503 |
| Alternative Catalog Number: | ATA-HPA061503-100,ATA-HPA061503-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C10orf63, CFAP106, enkurin, MGC26778 |
| enkurin, TRPC channel interacting protein |
| Anti-ENKUR |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 219670 |
| UniProt: | Q8TC29 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPKKNFDRNVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ENKUR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human fallopian tube and colon tissues using Anti-ENKUR antibody. Corresponding ENKUR RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bronchus, colon, fallopian tube and kidney using Anti-ENKUR antibody HPA061503 (A) shows similar protein distribution across tissues to independent antibody HPA037593 (B). |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-ENKUR antibody HPA061503. |
|
|
Immunohistochemical staining of human bronchus using Anti-ENKUR antibody HPA061503. |
|
|
HPA061503-100ul |
|
|
HPA061503-100ul |
|
|
HPA061503-100ul |
Product Guarantee and Expert Support
