Anti-KCNH6

Catalog Number: ATA-HPA061704
Article Name: Anti-KCNH6
Biozol Catalog Number: ATA-HPA061704
Supplier Catalog Number: HPA061704
Alternative Catalog Number: ATA-HPA061704-100,ATA-HPA061704-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: erg2, HERG2, Kv11.2
Clonality: Polyclonal
Isotype: IgG
NCBI: 81033
UniProt: Q9H252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
Target: KCNH6
Antibody Type: Monoclonal Antibody
HPA061704-100ul