Anti-PLCL2

Catalog Number: ATA-HPA061728
Article Name: Anti-PLCL2
Biozol Catalog Number: ATA-HPA061728
Supplier Catalog Number: HPA061728
Alternative Catalog Number: ATA-HPA061728-100,ATA-HPA061728-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1092, PLCE2
Clonality: Polyclonal
Isotype: IgG
NCBI: 23228
UniProt: Q9UPR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE
Target: PLCL2
Antibody Type: Monoclonal Antibody
HPA061728-100ul