Anti-DACT3
Catalog Number:
ATA-HPA061768
| Article Name: |
Anti-DACT3 |
| Biozol Catalog Number: |
ATA-HPA061768 |
| Supplier Catalog Number: |
HPA061768 |
| Alternative Catalog Number: |
ATA-HPA061768-100,ATA-HPA061768-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
DAPPER3, MGC15476, RRR1 |
| Rabbit Polyclonal DACT3 Antibody against Human dishevelled binding antagonist of beta catenin 3. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 |
| NCBI: |
147906 |
| UniProt: |
Q96B18 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
MIRAFSFPVSPERGRLRGWLEGSLAGLCELHWLRERQEYRVQQALRLAQPGMGGAEAEDEEDADE |
![]()
|
WB Image Caption 1 |
