Anti-ATP6V1F
Catalog Number:
ATA-HPA062011
- Images (8)
| Article Name: | Anti-ATP6V1F |
| Biozol Catalog Number: | ATA-HPA062011 |
| Supplier Catalog Number: | HPA062011 |
| Alternative Catalog Number: | ATA-HPA062011-100,ATA-HPA062011-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ATP6S14, VATF, Vma7 |
| ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F |
| Anti-ATP6V1F |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 9296 |
| UniProt: | Q16864 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ATP6V1F |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-ATP6V1F antibody. Corresponding ATP6V1F RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA062011-100ul |
|
|
|
|
|
HPA062011-100ul |
|
|
HPA062011-100ul |
Product Guarantee and Expert Support
