Anti-EMP3

Catalog Number: ATA-HPA062030
Article Name: Anti-EMP3
Biozol Catalog Number: ATA-HPA062030
Supplier Catalog Number: HPA062030
Alternative Catalog Number: ATA-HPA062030-100,ATA-HPA062030-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: YMP
Clonality: Polyclonal
Isotype: IgG
NCBI: 2014
UniProt: P54852
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGW
Target: EMP3
Antibody Type: Monoclonal Antibody
HPA062030-100ul