Anti-CAPN9

Catalog Number: ATA-HPA062050
Article Name: Anti-CAPN9
Biozol Catalog Number: ATA-HPA062050
Supplier Catalog Number: HPA062050
Alternative Catalog Number: ATA-HPA062050-100,ATA-HPA062050-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GC36, nCL-4
Clonality: Polyclonal
Isotype: IgG
NCBI: 10753
UniProt: O14815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNIN
Target: CAPN9
Antibody Type: Monoclonal Antibody
HPA062050-100ul