Anti-NLRP4

Catalog Number: ATA-HPA062128
Article Name: Anti-NLRP4
Biozol Catalog Number: ATA-HPA062128
Supplier Catalog Number: HPA062128
Alternative Catalog Number: ATA-HPA062128-100,ATA-HPA062128-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLR19.5, CT58, FLJ32126, NALP4, PAN2, PYPAF4, RNH2
Clonality: Polyclonal
Isotype: IgG
NCBI: 147945
UniProt: Q96MN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS
Target: NLRP4
Antibody Type: Monoclonal Antibody
HPA062128-100ul