Anti-PADI1
Catalog Number:
ATA-HPA062294
- Images (8)
| Article Name: | Anti-PADI1 |
| Biozol Catalog Number: | ATA-HPA062294 |
| Supplier Catalog Number: | HPA062294 |
| Alternative Catalog Number: | ATA-HPA062294-100,ATA-HPA062294-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HPAD10, PAD1, PDI, PDI1 |
| peptidyl arginine deiminase, type I |
| Anti-PADI1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 29943 |
| UniProt: | Q9ULC6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PADI1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line HaCaT shows localization to cytosol. |
|
|
Immunohistochemistry analysis in human esophagus and colon tissues using Anti-PADI1 antibody. Corresponding PADI1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human esophagus shows high expression. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
HPA062294-100ul |
|
|
|
|
|
HPA062294-100ul |
|
|
HPA062294-100ul |
Product Guarantee and Expert Support
