Anti-S100A2

Catalog Number: ATA-HPA062451
Article Name: Anti-S100A2
Biozol Catalog Number: ATA-HPA062451
Supplier Catalog Number: HPA062451
Alternative Catalog Number: ATA-HPA062451-100,ATA-HPA062451-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAN19, S100L
S100 calcium binding protein A2
Anti-S100A2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 6273
UniProt: P29034
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: S100A2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human esophagus and stomach tissues using Anti-S100A2 antibody. Corresponding S100A2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human esophagus shows high expression.
Immunohistochemical staining of human stomach shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA062451-100ul
HPA062451-100ul
HPA062451-100ul