Anti-IP6K3

Catalog Number: ATA-HPA062531
Article Name: Anti-IP6K3
Biozol Catalog Number: ATA-HPA062531
Supplier Catalog Number: HPA062531
Alternative Catalog Number: ATA-HPA062531-100,ATA-HPA062531-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IHPK3, INSP6K3
Clonality: Polyclonal
Isotype: IgG
NCBI: 117283
UniProt: Q96PC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID
Target: IP6K3
Antibody Type: Monoclonal Antibody
HPA062531-100ul