Anti-NUP85
Catalog Number:
ATA-HPA062595
- Images (8)
| Article Name: | Anti-NUP85 |
| Biozol Catalog Number: | ATA-HPA062595 |
| Supplier Catalog Number: | HPA062595 |
| Alternative Catalog Number: | ATA-HPA062595-100,ATA-HPA062595-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ12549, NUP75 |
| nucleoporin 85kDa |
| Anti-NUP85 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 79902 |
| UniProt: | Q9BW27 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPSCPFIYIIRKDVDVYSQILRKLFNESHGIFL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUP85 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-NUP85 antibody. Corresponding NUP85 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line RT-4 |
|
|
HPA062595-100ul |
|
|
|
|
|
HPA062595-100ul |
|
|
HPA062595-100ul |
Product Guarantee and Expert Support
