Anti-LRTM2

Catalog Number: ATA-HPA062745
Article Name: Anti-LRTM2
Biozol Catalog Number: ATA-HPA062745
Supplier Catalog Number: HPA062745
Alternative Catalog Number: ATA-HPA062745-100,ATA-HPA062745-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 654429
UniProt: Q8N967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EWFSYRGGRLDQLACTLPKELRGKDMRMVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKP
Target: LRTM2
Antibody Type: Monoclonal Antibody
HPA062745-100ul