Anti-PSKH1

Catalog Number: ATA-HPA062763
Article Name: Anti-PSKH1
Biozol Catalog Number: ATA-HPA062763
Supplier Catalog Number: HPA062763
Alternative Catalog Number: ATA-HPA062763-100,ATA-HPA062763-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 5681
UniProt: P11801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAG
Target: PSKH1
Antibody Type: Monoclonal Antibody
HPA062763-100ul