Anti-PLEKHG7

Catalog Number: ATA-HPA062856
Article Name: Anti-PLEKHG7
Biozol Catalog Number: ATA-HPA062856
Supplier Catalog Number: HPA062856
Alternative Catalog Number: ATA-HPA062856-100,ATA-HPA062856-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C12orf74
Clonality: Polyclonal
Isotype: IgG
NCBI: 440107
UniProt: Q32Q52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLLQFDRQAPGRISTSPTLRRLRTRGCGTRQDAWQVTTWGSWGAPVGFPCYLSKSLPGSPKDS
Target: PLEKHG7
Antibody Type: Monoclonal Antibody
HPA062856-100ul